Overview
Cat #:
STS-800
Alternative Name SpTx1
Lyophilized Powder yes
Origin Scolopendra polymorpha
Source Synthetic peptide
MW: 6366 Da
Purity: >98% (HPLC)
Form Lyophilized powder
Effective concentration 15 - 50 nM
Sequence ADLIKKKLPFRTRSKFPRKSECVQDCAKAFTNGNKDKIKDVKSEFFSCYCWYEA-OH
Modifications Disulfide bonds location - The exact location of the disulfide bridges is currently unknown.
Molecular formula C286H441N77O80S4
Activity SpTx-1 inhibits hKATP channels with a Kd of 15 nM by blocking the hKir6.2 pore1.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in water. Centrifuge all products before use (10000 x, g 5 min). It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles.
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C.
Scientific background SpTx-1 is a 54 amino acid peptidyl toxin originally isolated from the venom of the centipede, Scolopendra polymorpha. This toxin blocks the adenosine triphosphate (ATP)-sensitive K+ (KATP) channel with a Kd value of 15 nM, primarily by targeting of the pore-forming inwardly rectifying K+ channel (Kir) 6.2 subunit that is coexpressed with the regulatory sulfonylurea receptor 1 (SUR1)1.
The KATP channel is a hetero-octameric protein complex, consisting of four Kir6.x pore subunits and four regulatory ATP-binding cassette SURx subunits. The KATP channels are present in many different tissues such as skeletal muscle, smooth muscle, pancreatic β-cells, cardiomyocytes, and brain. Since these channels are responsible for linking cell metabolism and membrane potential, they are crucial for the regulation of different cellular pathways2. Kir6.x or SUR mutations result in KATP channelopathies, which reflect the physiological roles of these channels, including but not limited to insulin secretion, cardiac protection, neuroprotection, and blood flow regulation3,4.
Target hKATP inhibitor, Kir6.2
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 23/05/2024
