Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Inward Rectifier K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

SsdTx3

Kappa-scoloptoxin (15)-Ssd3a, Kappa-SLPTX(15)-Ssd3, Toxin SSD893, k- SLPTX(15)-Ssd3

A human KATP (Kir6.2/SUR1) potassium channel blocker

Back to product page SDS

Overview

Cat #: STS-670
Alternative Name Kappa-scoloptoxin (15)-Ssd3a, Kappa-SLPTX(15)-Ssd3, Toxin SSD893, k- SLPTX(15)-Ssd3
Lyophilized Powder yes
Origin Scolopendra subspinipes dehaani (Thai centipede)
Source Synthetic
MW: 6101 Da
Purity: >98% (HPLC)
Form Lyophilized powder
Effective concentration 100-500 nM
Sequence EVIRKEIPYKKRKFPYKSECRKACATAFTGGDESRIKDVKPGFFKCSCYYSSG
Structure
  • The exact location of the disulfide bridges is currently unknown.

    The exact location of the disulfide bridges is currently unknown.
Molecular formula C273H422N74O77S4
Activity SsdTx3 inhibits hKATP channels with a Kd of <300 nM by blocking the hKir6.2 pore1.
Accession number P0DPV6
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in water.
Centrifuge all products before use (10000 x g 5 min).
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
Our bioassay
  • Alomone Labs SsdTx3 inhibits Kir6.2/SUR1 channels stably expressed in HEK-293 cells.
    Alomone Labs SsdTx3 inhibits Kir6.2/SUR1 channels stably expressed in HEK-293 cells.
    A. The percent inhibition of KATP channels (comprising Kir6.2 + SUR1 subunits) stably expressed in HEK-293 cells, in the presence of different concentrations of SsdTx3 (#STS-670). The KATP channels were recorded using the whole cell patch clamp technique. An IC50 value of 376 nM was found for Ssd3a in this experiment.
    B. A representative cell recording showing the KATP (Kir6.2 + SUR1) currents (I in nA) under control conditions (without toxin) compared to conditions with different concentrations of SsdTx3. The data indicated that the toxin-mediated inhibition was reversible.
Scientific background

SsdTx3 (kappa-scoloptoxin(15)-Ssd3a) is a toxin isolated from the venom of the centipede Scolopendra subspinipes dehaani, a species that inhabits Asia. SsdTx3 was found to be an inhibitor of hKATP channels by blocking the hKir6.2 pore co-expressed with hSUR1. Dose-Response curve of the hKATP channels inhibition revealed that SsdTx3 inhibits hKATP channels with a Kd values of 278nM1.

SsdTx belongs to a family of five proteins, discovered so far from a multiple centipede species, that target hKATP channel by blocking the hKir6.2 pore. They have conserved features of four cysteine residues and a P-P segment that contains positively charged residues important for blocking the K+ pore1.

ATP-sensitive K+ ion channels (KATP channels) can be found in many different tissues such as pancreatic β-cells, carried myocytes, skeletal muscle, smooth muscle and brain. KATP channels are responsible for linking between the cell metabolism and the membrane potential and therefore they are critical for the regulation of different cellular pathways2.

Target KATP inhibitor
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Guinea pig Anti-Kir6.2 Antibody (#APC-020-GP (formerly AGP-067))

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Tertiapin (#STT-250)
  2. Tertiapin-Q (#STT-170)
Blockers/Antagonists: small molecules
  1. Gambogic acid (#G-250)

Explorer kits & Research packs

Explorer kits
  1. Kir Channel Blocker Explorer Kit (#EK-112)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order