Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Stichodactyla Toxin-ATTO Fluor-590

K+ channel toxin ShK, Toxin κ-stichotoxin-She1a, κ-SHTX-She1a

Fluorescent ShK Conjugate for Sensitive Detection of KV Channels

Back to product page SDS

Overview

Cat #: STS-400-AR
Alternative Name K+ channel toxin ShK, Toxin κ-stichotoxin-She1a, κ-SHTX-She1a
Lyophilized Powder yes
Origin Modified synthetic peptide originated from Stichodactyla helianthus (Caribbean sea anemone).
MW: ~4627 Da
Purity: >99% (HPLC)
Form Lyophilized powder.
Effective concentration 1-100 nM.
Sequence RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC.
Modifications Cys3-Cys35, Cys12-Cys28, Cys17-Cys32.
Label ATTO-590. ATTO dyes are characterized by strong absorption (high extinction coefficient), high fluorescence quantum yield, and high photo-stability. ATTO-590 maximum absorption is 593 nm and maximum fluorescence is at 622 nm. The fluorescence is excited most efficiently in the 575-610 nm range. The extent of labeling is 1 molecule of dye per molecule ShK.
Structure
Activity Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels1-3.
References-Activity
  1. Pennington, M.W. et al. (1995) Int. J. Pept. Protein Res. 46, 354.
  2. Beeton, C. et al. (2003) J. Biol. Chem. 278, 9928.
  3. Middleton, R.E. et al. (2003) Biochemistry 42, 13698.
Accession number P29187.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
  • Binding of Stichodactyla Toxin-ATTO Fluor-590 to Purkinje cells in the rat cerebellum.
    Binding of Stichodactyla Toxin-ATTO Fluor-590 to Purkinje cells in the rat cerebellum.
    Lightly-fixed floating rat brain sections were labeled with Stichodactyla Toxin-ATTO Fluor-590 (#STS-400-AR), (100 nM). A. Staining of Purkinje cells in the cerebellum (arrows). B. Staining of neurons in the deep cerebellar nuclei (arrows). DAPI is used as the counterstain (blue).
  • Alomone Labs Stichodactyla Toxin-ATTO Fluor-590 blocks KV1.3 channels expressed in Xenopus oocytes.
    Alomone Labs Stichodactyla Toxin-ATTO Fluor-590 blocks KV1.3 channels expressed in Xenopus oocytes.
    A. Representative time course of Stichodactyla Toxin-ATTO Fluor-590 (#STS-400-AR) inhibition of KV1.3 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and significantly inhibited by 10 nM Stichodactyla Toxin-ATTO Fluor-590 (green). B. Superimposed traces of KV1.3 current after application of control (black) and of 10 nM Stichodactyla Toxin-ATTO Fluor-590 (green), taken from the recording in A.
Scientific background

ShK (Stichodactyla Toxin) is a peptide toxin originally isolated from the nematocyst of the sea anemone Stichodactyla helianthus1.

ShK blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. It has been shown to block KV current in DRG neurons, to displace radioactive Dendrotoxin from brain synaptosomes1 and inhibit I125-Charybdotoxin binding to Jurkat T lymphocytes with an IC50 of 32 pM2,4.

Evidence also suggests that native KV currents in the central nervous system, which are predominantly carried by KV1.2 channels, are highly sensitive to this toxin5.

A fluorescently labeled synthetic ShK is used to recognize and to sort KV1.3 containing lymphocytes4,6.

Target KV1.1, KV1.3, KV1.4, KV1.6 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-KV1.1 (KCNA1) Antibody (#APC-009)
  2. Anti-KV1.1 (KCNA1) (extracellular) Antibody (#APC-161)
  3. Anti-KV1.1 (KCNA1) (extracellular)-ATTO Fluor-594 Antibody (#APC-161-AR)
  4. Anti-KV1.3 (KCNA3) Antibody (#APC-002)
  5. Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101)
  6. Anti-KV1.3 (KCNA3) (extracellular)-FITC Antibody (#APC-101-F)
  7. Anti-KV1.3 (KCNA3) (extracellular)-PE Antibody (#APC-101-PE)
  8. Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101-GP (formerly AGP-005))
  9. Anti-KV1.6 (KCNA6) Antibody (#APC-003)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. ShK (Stichodactyla Toxin) (#STS-400)
  2. Stichodactyla Toxin-Biotin (#STS-400-B)
  3. α-Dendrotoxin (#D-350)
  4. δ-Dendrotoxin (#D-380)
  5. Aa1 Toxin (#RTA-400)
  6. Aam-KTX (#STA-110)
  7. ADWX-1 (#STW-100)
  8. Urotoxin (#STU-200)

Explorer kits & Research packs

Explorer kits
  1. Shaker (KV1) Channel Antibody Explorer Kit (#AK-219)
  2. Shaker (KV1) Channel Blocker Explorer Kit (#EK-107)
  3. Cardiac Channel Blocker Explorer Kit (#EK-345)
Research packs
  1. KV1.2 (KCNA2) Channel Basic Research Pack (#ESB-500)
  2. KV1.2 (KCNA2) Channel Premium Research Pack (#ESP-500)
  3. KV1.2 (KCNA2) Channel Deluxe Research Pack (#ESD-500)
  4. KV1.3 (KCNA3) Channel Basic Research Pack (#ESB-501)
  5. KV1.3 (KCNA3) Channel Premium Research Pack (#ESP-501)
  6. KV1.3 (KCNA3) Channel Deluxe Research Pack (#ESD-501)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order