Overview
Cat #:
STT-400
Alternative Name K+ channel toxin α-KTx 5.4
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3458.16 Da
Purity: >98% (HPLC)
Effective concentration 500 pM - 50 nM.
Sequence AFCNLRRCELSCRSLGLLGKCIGEECKCVPY.
Modifications Disulfide bonds between Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28. Tyr31 - C terminal amidation.
Molecular formula C146H238N44O41S6
Activity Tamapin blocks KCa2 channels. Tamapin displays a remarkable selectivity for KCa2.2 versus KCa2.1 channels1.
References-Activity
- Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101.
Accession number
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Tamapin completely inhibits KCa2.2 (SK2) currents heterologously expressed in Xenopus oocytes.Current traces recorded at +5 mV. At the indicated time (arrow) 25 nl of 100 mM CaCl2 was injected into the oocyte in order to activate outward current. 100 nM Tamapin (#STT-400) were perfused for 1 min (green) to completely inhibit the current.
Scientific background Tamapin is a 31 amino acid peptidyl toxin, isolated from the venom of the Indian red scorpion, Mesobuthus tamulus, and is classified as α-5.4 scorpion toxin family1 with three disulfide bridges. Native Tamapin blocks KCa2 channels in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct KCa2 channel subunits. Tamapin displays a remarkable selectivity for KCa2.2 (SK2/KCNN2, IC50 = 24 pM) versus KCa2.1 (SK1/KCNN1, approx 1750 fold) and KCa2.3 (SK3/KCNN3) channels2.
Target KCa2 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations
