Overview
Cat #:
STT-360-AR
Lyophilized Powder yes
Origin Synthetic peptide
MW: ~4900 Da
Purity: >98% (HPLC)
Effective concentration 0.5-50 nM.
Sequence VFINAKCRGSPECLPKCKECIGKAAGKCMNGKCKCYP.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35. Amino acid Alanine at position 20 was replaced by Cysteine (Bold in the sequence).
Label ATTO-594. Maximum absorption 601 nm; Maximum fluorescence 627 nm. The fluorescence is excited most efficiently in the 580 - 615 nm range. This label belongs to the class of Rhodamine dyes and can be used with fluorescent equipment typically optimized to detect Texas Red and Alexa-594.
Structure
Activity Tityustoxin-Kα blocks cloned KV1.2 with high potency1,2.
Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
References-Activity
- Rogowski, R.S. et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 1475.
- Werkman, T.R. et al. (1993) Mol. Pharmacol. 44, 430.
- Williams, M.R. et al. (2012) J. Neurosci. 32, 9228.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Avoid exposure to light.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). Avoid exposure to light. The product is lyophilized in 0.5 ml conical vial.
Storage of solutions Up to two weeks at 4°C or three months at -20°C. Avoid exposure to light.
Our bioassay
Tityustoxin-Kα-ATTO Fluor-594 labels KV1.2 channel in mouse cerebellum.A. Staining of free-floating mouse brain sections using Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR) (red). Sections were then stained using Anti-KV1.2 (KCNA2) Antibody (#APC-010) (1:200) followed by goat anti-rabbit-AlexaFluor-488 (green). Tityustoxin-Kα-ATTO Fluor-594 and KV1.2 are both detected in the pinceau structures (yellow staining, arrow) of the cerebellum. B. Same brain sections as in A were labeled with Tityustoxin-Kα-ATTO Fluor-594 (red) followed by anti-Parvalbumin. Tityustoxin-Kα-ATTO Fluor-594 (red) labeled the pinceau structures (arrow) of the cerebellum. Parvalbumin stained not only the pinceau but also the soma of Purkinje cells. Co-localization between the two is depicted in yellow.
Alomone Labs Tityustoxin-Kα-ATTO Fluor-594 binds KV1.2 including β2 transfected HEK293T cells and is displaced by unlabeled Tityustoxin-Kα.HEK293T cells transfected with KV1.2 and β2 were incubated with 200 nM Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR) in the absence (A,B) and presence (C,D) of 5 µM Tityustoxin-Kα (#STT-360). Similar results were observed by using 100 nM Tityustoxin-Kα-ATTO Fluor-594 (data not shown).
Alomone Labs Tityustoxin-Kα-ATTO Fluor-594 inhibits rKV1.2 heterologously expressed in Xenopus oocytes.A. Time course of KV1.2 channel currents at 60 mV before (black) and during (green) application of 100 nM Tityustoxin-Kα-ATTO Fluor-594 (#STT-360-AR) for 1 min (indicated as bar). Currents were elicited by application of voltage ramp from a holding potential of -80 mV to +60 mV in 100 ms. B. Example of superimposed current traces before (black) and during (green) 100 nM application of Tityustoxin-Kα-ATTO Fluor-594.
Scientific background
Tityustoxin Kα (#STT-360) is a potent and specific blocker of KV1.2 channels1,2. It was originally isolated from the scorpion Tityus serrulatus venom2.
The labeled version of the toxin, Tityustoxin-Kα-ATTO Fluor-594, has been tested in electrophysiology applications and is specially suited to experiments requiring simultaneous labeling of different markers.
Target KV1.2 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 08/01/2024
Specifications
Citations
Citations
