Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Vm24 Toxin

alpha-KTx 23.1

A Potent and Specific Blocker of Kv1.3 Channel

Back to product page SDS

Overview

Cat #: STV-055
Alternative Name alpha-KTx 23.1
Lyophilized Powder yes
Origin Vaejovis mexicanus smithi, (Mexican scorpion)
Source Synthetic peptide
MW: 3864 Da
Purity: ≥98%
Form Lyophilized Powder
Effective concentration 3-10 pM
Sequence AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC-NH2
Modifications Cys36: C-terminal amidation
Disulfide bonds location - Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36
Molecular formula C157H253N51O45S9
Activity Vm24 toxin is a potent and selective Kv1.3 channel blocker (Kd ∼ 3 pM)1. This toxin exhibits more than 1500-fold selectivity for Kv1.3 over KCa3.1, Kv1.1, and Kv1.2 and does not inhibit a wide range of other channels2. Vm24 inhibits the proliferation and Ca2+ signaling of human T cells in vitro and reduces delayed-type hypersensitivity reactions in rats in vivo2.
Accession number 2K9O
Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, it should be stored at -20°C. Protect from moisture.
Solubility Soluble in water. For long-term storage in solution, we recommend to prepare a stock solution by dissolving the product in ddH2O at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer. Centrifuge all product preparations before use (10000 x g, 5 min). Repeated freeze-thawing might result in loss of activity. [It is recommended to prepare working solutions fresh before use].
Storage of solutions The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thawing cycles.
Scientific background

The Vm24 toxin, also known as Vaejovis mexicanus peptide 24, is a potent blocker of Kv1.3 in human lymphocytes. Isolated from the venom of the Mexican scorpion Vaejovis mexicanus smithi, Vm24 is a 36-residue peptide with a molecular mass of 3864 Da, and has been identified as the first example of a new subfamily of α-type K(+) ion channel blockers (α-KTx 23.1)1.

Vm24, a natural immunosuppressive peptide, potently and selectively blocks Kv1.3 in human T cells with high affinity. The blockage of Kv1.3 channels in T cells is a promising therapeutic approach for the treatment of autoimmune diseases such as multiple sclerosis and type 1 diabetes mellitus2.

The voltage-gated potassium channel known as Kv1.3 (KCNA3) is expressed by a subset of chronically activated memory T cells and plays an important role in their activation and proliferation, especially in primary malignant T cells. The potent Kv1.3 inhibitor Vm24 inhibits CD3/CD28-induced proliferation and IL-9 expression, thus inhibiting activation-induced proliferation as well as cytokine and cytokine receptor expression in malignant T cells3.

Due to its high specificity, the Vm24 toxin enables to define the downstream functions of Kv1.3 channels in human CD4+ TEM lymphocytes. Blocking Kv1.3 channels profoundly affects the mRNA synthesis machinery, the unfolded protein response and intracellular vesicle transport, impairing the synthesis and secretion of cytokines in response to TCR engagement. This underscores the role of Kv1.3 channels in regulating TEM lymphocyte function4.

KV1.3 blockers change the course of Alzheimer's Disease (AD) development, reducing microglial cytotoxic activation and increasing neural stem cell differentiation. KV1.3 blockers inhibit microglia-mediated neurotoxicity in cell cultures, reducing the expression and production of the pro-inflammatory cytokines IL-1β and TNF-α via the NF-kB and p38MAPK pathway. Microglia activation correlates with an increase in KV1.3 channel expression and current density. Several studies highlight the importance of KV1.3 in the activation of the inflammatory response and the inhibition of neural progenitor cell proliferation and neuronal differentiation. Thus, KV1.3 blockers such as Vm24 possess potential therapeutic benefits for patients suffering from Alzheimer’s disease5

Target Kv1.3 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101)
  2. Anti-KV1.3 (KCNA3) (extracellular)-Biotin Antibody (#APC-101-B)
  3. Anti-KV1.3 (KCNA3) (extracellular)-FITC Antibody (#APC-101-F)
  4. Anti-KV1.3 (KCNA3) (extracellular)-PE Antibody (#APC-101-PE)
  5. Anti-KV1.3 (KCNA3) Antibody (#APC-002)
  6. Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody (#APC-101-GP (formerly AGP-005))

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. ADWX-1 (#STW-100)
  2. Agitoxin-1 (#STA-150)
  3. Agitoxin-2 (#STA-420)
  4. Agitoxin-2-Cys-TAMRA (#RTA-420-T)
  5. Agitoxin-3 (#STA-390)
  6. HsTx1 Toxin (#STH-300)
  7. KTX-Sp2 (#STK-050)
  8. Margatoxin (#STM-325)
  9. ShK (Stichodactyla Toxin) (#STS-400)
  10. ShK-186 (#STS-390)
  11. Stichodactyla Toxin-ATTO Fluor-590 (#STS-400-AR)
  12. Stichodactyla Toxin-Biotin (#STS-400-B)
Blockers/Antagonists: small molecules
  1. CP 339818 hydrochloride (#C-115)
  2. UK-78282 hydrochloride (#U-100)

Explorer kits & Research packs

Explorer kits
  1. Shaker (KV1) Channel Blocker Explorer Kit (#EK-107)
Research packs
  1. KV1.3 (KCNA3) Channel Basic Research Pack (#ESB-501)
  2. KV1.3 (KCNA3) Channel Deluxe Research Pack (#ESD-501)
  3. KV1.3 (KCNA3) Channel Premium Research Pack (#ESP-501)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 50 µg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order