Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › TRP Channels › TRPA1 Channel › Activators

Certificate of Analysis

  • Bioassay Tested
    The specificity of this antibody has been validated in a knockout (KO) or knockdown (KD) system.

Wasabi Receptor Toxin

WaTx

A Cell-Penetrating Activator of TRPA1 Channel

Back to product page SDS

Overview

Cat #: STW-200
Alternative Name WaTx
Lyophilized Powder yes
Source Synthetic peptide
MW: 3855 Da
Purity: >98% (HPLC)
Form Lyophilized powder
Effective concentration 0.5-5 µM
Sequence ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
Modifications Disulfide bonds between: Cys44-Cys62, Cys48-Cys58
Molecular formula C164H245N45O53S5
Activity Wasabi Receptor Toxin is a cell penetrating peptide toxin activator of TRPA1 Channel1.
Accession number C0HLG4
Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, it should be stored at -20°C. Protect from moisture.
Solubility Soluble in water. Centrifuge all products before use (10000 x g 5 min).
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
Our bioassay
  • Alomone Labs Wasabi receptor toxin leads to Ca2+ signals in HEK 293 cells transfected with TRPA1.
    Alomone Labs Wasabi receptor toxin leads to Ca2+ signals in HEK 293 cells transfected with TRPA1.
    A. Upper, individual traces (grey) and mean trace (black) of changes in intracellular Ca2+ concentration with time (measured as a change in FURA-2AM fluorescent intensity) in HEK 293 cells transfected with human TRPA1, following application of 5 µM Wasabi receptor toxin (#STW-200) followed by 200 µM AITC. Bottom, Mean ± SEM of changes in intracellular Ca2+ in HEK 293 cells transfected with human TRPA1, following application of 5 µM Wasabi receptor toxin followed by 200 µM AITC. n = 42 cells, representative of 5 plates. B. Same as in A, but in untransfected HEK 293 cells. Ionomycin was added at the end of each experiment. n = 60 cells, representative of 3 plates.  

    Figure kindly provided by Prof. Alexander Binshtok, Dept. Medical Neurobiology, Institute for Medical Research, IMRIC, Hebrew University School of Medicine, Jerusalem.
Scientific background

Wasabi receptor toxin (WaTx) is a peptide toxin originally isolated from Urodacus manicatus (Australian Black Rock scorpion) venom. The peptide toxin activates TRPA1 channel by a novel mechanism: it penetrates the cell and stabilizes the channel’s open state, thereby causing pain1.

TRPA1 ion channel is a chemosensory receptor for a broad class of volatile environmental irritants. It is expressed in sensory neurons and activated by natural products from mustard and allium plants. This activation elicits the sinus clearing or eye stinging pain one experiences when eating wasabi or chopping an onion2.

TRPA1 is also a sensor for endogenous inflammatory agents that directly activate this channel to produce acute and persistent pain2. TRPA1 is considered a promising therapeutic target for treating chronic pain, itch, and neurogenic inflammatory syndromes3.

Target TRPA1 channel
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Related Products

Antibodies

  1. Anti-TRPA1 (extracellular) Antibody (#ACC-037)

Pharmacological tools

Blockers/Antagonists: small molecules
  1. A 967079 (#A-225)
  2. AMG-9090 (#A-300)
  3. AP-18 (#A-250)
  4. HC-030031 (#H-105)
  5. HMA (#H-130)
Activators/Agonists: small molecules
  1. 4-ONE (#O-145)
  2. Capsiate (#C-255)
  3. Ononetin (#O-135)
  4. Optovin (#O-140)

Explorer kits & Research packs

Explorer kits
  1. TRPA1 Channel Activator Explorer Kit (#EK-123)
  2. TRPA1 Channel Blocker Explorer Kit (#EK-121)
  3. TRPA1 Channel Modulator Explorer Kit (#EK-120)
Research packs
  1. TRPA1 Channel Basic Research Pack (#ESB-302)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 0.1 mg free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order