Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › Ion Channels › Cl- Channels › Voltage-Gated Cl- Channels › Antibodies

Certificate of Analysis

  • KO Validated
    This antibody has undergone quality control and has been approved by our professional team. See applications.

Anti-CLC-3 (CLCN3) Antibody

Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

Back to product page SDS

Overview

Cat #: ACL-001
Alternative Name Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3 (Accession P51792). Intracellular, near the C-terminus.
Accession (Uniprot) Number P51792
Gene ID 84360
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Mouse - identical; human, rabbit, guinea pig - 69/70 amino acid residues identical; Xenopus laevis - 61/70 amino acid residues identical.
Rat CLC-4 - 46/70 amino acid residues identical; rat CLC-5 - 49/70 amino acid residues identical.
RRID AB_2039814.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.8 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, ip, wb
May also work in: ifc*
Western blot
  • Rat brain membranes (1:200-1:300).

    Human glioma lysates (1:500), (Cuddapah, V.A. et al. (2013) J. Neurosci. 33, 1427.) .
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-CLC-3 (CLCN3) Antibody (#ACL-001), (1:200).
    2. 
    Anti-CLC-3 (CLCN3) Antibody, preincubated with CLC-3/CLCN3 Blocking peptide (#BLP-CL001).
  • Western blot analysis of membranes from Xenopus oocytes, expressing CLC-3, CLC-4, and CLC-5, using Anti-CLC-3 (CLCN3) Antibody (#ACL-001) (kindly provided by Prof. Jordi Ehrenfeld, University of Nice).
    Western blot analysis of membranes from Xenopus oocytes, expressing CLC-3, CLC-4, and CLC-5, using Anti-CLC-3 (CLCN3) Antibody (#ACL-001) (kindly provided by Prof. Jordi Ehrenfeld, University of Nice).
Immunoprecipitation
  • tsA cells expressing CLC-3 (Farmer, L.M. et al. (2013) J. Physiol. 591, 1001.).
Immunohistochemistry
  • Rat brain sections (1:100) (Farmer, L.M. et al. (2013) J. Physiol. 591, 1001.).
Immunocytochemistry
  • tsA cells expressing CLC-3 (Farmer, L.M. et al. (2013) J. Physiol. 591, 1001.).
Scientific background

CLC-3 is a member of the voltage-dependent Cl- channel (CLC) family that includes nine known members in mammals. CLC channels can be classified as plasma membrane channels and intracellular organelle channels. The first group includes the CLC-1, CLC-2 CLC-Ka and CLCKb channels. The second group comprises the CLC-3, CLC-4, CLC-5, CLC-6 and CLC-7.

CLC channels that function in the plasma membrane are involved in the stabilization of membrane potential and in transepithelial transport. The presumed function of the intracellular CLC channels is support of the acidification of the intraorganellar compartment. In this regard, recent reports indicate that ClC-4 and ClC-5 (and by inference ClC-3) can function as Cl-/H+ antiporters.1, 2

The functional unit of the CLC channels is a dimer with each subunit forming a proper pore. Although the crystal structure of bacterial CLC channels was resolved, the topology of the CLC channels is complex and has not been fully elucidated. It is generally accepted that both the N- and C- terminus domains are intracellular while the number and configuration of the transmembrane domains vary greatly between different models. 1,2

CLC-3 is widely distributed with prominent expression in tissues of neuroectoderm origin. In the brain, it is highly expressed in the hippocampus, olfactory bulb and olfactory cortex. The channel is also prominently expressed in aortic and coronary vascular smooth muscle cells, aortic endothelial cells and tracheal and alveolar epithelial cells.

The physiological function of CLC-3 is not entirely clear, but it has been suggested that CLC-3 generates a shunt current of chloride for v-H+-ATPases, thereby aiding the acidification of endosomes and synaptic vesicles as well as lysosomes. Disruption of the ClC-3 gene in mice causes severe neuronal loss, leading to a complete loss of the hippocampus in adult mice. In addition, CLC-3 has been shown to have a critical role in the respiratory burst and phagocytosis of polymorphonuclear cells, a key cell type of innate host defense. 3,4

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Lyophilized Powder
Image & Title:

Anti-CLC-3 (CLCN3) Antibody
Colocalization and expression of KCa3.1, ClC-3 and B2R in glioma cells.A-C. Immunocytochemical staining of human D54 glioma cells using Mouse Anti-KCNN4 (KCa3.1, SK4) (extracellular) Antibody (#ALM-051). KCNN4, ClC-3 and B2R co-localize to the edges of cells. D. Western blot analysis of a number of glioma cells using Anti-CLC-3 (CLCN3) Antibody (#ACL-001) and Mouse Anti-KCNN4 (KCa3.1, SK4) (extracellular) Antibody.Adapted from Cuddapah, V.A. et al. (2013) with permission of the Society for Neuroscience.

For research purposes only, not for human use
Last Update: 03/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • CLC-3/CLCN3 Blocking Peptide (#BLP-CL001) is the original antigen used for immunization during Anti-CLC-3 (CLCN3) Antibody (#ACL-001) generation. The blocking peptide binds and ‘blocks’ Anti-CLC-3/CLCN3 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

    CLC-3/CLCN3 Blocking Peptide (#BLP-CL001)

Related Products

Antibodies

  1. Anti-CLC-1 (CLCN1) Antibody (#ACL-005)
  2. Anti-CLC-2 (CLCN2) Antibody (#ACL-002)
  3. Anti-CLC-5 Antibody (#ACL-003)
  4. Anti-CLC-7 (CLCN7) Antibody (#ACL-008)
  5. Anti-CLC-K Antibody (#ACL-004)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Chlorotoxin (#RTC-450)

Explorer kits & Research packs

Explorer kits
  1. Voltage-Gated Cl- Channel Antibody Explorer Kit (#AK-415)
  2. Lysosomal Ion Channel Antibody Explorer Kit (#AK-530)

Resources

  • The Involvement of Ion Channels in Cell Proliferation
  • Cl– Channels Come into Focus

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • The Involvement of Ion Channels in Cell Proliferation

  • Cl– Channels Come into Focus

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µl free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order