Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • NaV Channels
      • Microglia Markers
      • CaV Channels
      • ASICs
      • nAChR
      • TRPV1
      • NMDA Receptor
      • KCa Channels
    • column
      • Tips
      • Protocols
      • Blog
      • Articles
    • column
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
      • Venom-Derived Ion Channel Modulators
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
Return to Content
Home › Products › G-Protein Coupled Receptors › Muscarinic Receptors › Antibodies

Certificate of Analysis

  • KO Validated
    This antibody has undergone quality control and has been approved by our professional team. See applications.

Anti-CHRM1 Antibody

Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1

Back to product page SDS

Overview

Cat #: AMR-001
Alternative Name Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
Immunogen
  • GST fusion protein with the sequence GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human M1 (Accession P11229). 3rd intracellular loop.
Accession (Uniprot) Number P11229
Gene ID 1128
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Macaca mulatta - 125/127 amino acid residues identical; mouse - 124/127 amino acid residues identical; pig - 124/127 amino acid residues identical; rat - 123/127 amino acid residues identical; gerbil - 123/127 amino acid residues identical.
RRID AB_2039993.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.85 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, wb
May also work in: ifc*, ip*
Western blot
  • Rat brain lysate (1:200).
  • Western blot analysis of rat brain membranes:
    Western blot analysis of rat brain membranes:
    1. Anti-CHRM1 Antibody (#AMR-001), (1:200).
    2. Anti-CHRM1 Antibody, preincubated with CHRM1 Blocking Peptide (#BLP-MR001).
Immunohistochemistry
  • Rat and mouse striatum sections. Human colon (1:50) (Harrington, A.M. et al. (2010) Neurogastroenterol. Motil. 22, 999.).
Immunocytochemistry
  • Transfected CHO cells (Kovoor, A. et al. (2005) J. Neurosci. 25, 2157.).
Scientific background

The action of the neurotransmitter acetylcholine (ACh) is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors  belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and named M1-M5.1-2

The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2

Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The M1 receptors are the most abundant muscarinic subtype in the cortex and striatum. M1 receptors were also localized in the myenteric plexus where they function as autoreceptors to enhance the release of ACh from the nerves.5-6

The M1, M3 and M5 receptors, which are coupled to Gq/11 proteins, can protect cells from undergoing apoptosis induced by DNA damage. The signaling mechanism that mediates this anti-apoptotic response is still poorly understood. However, it was recently reported that a poly-basic motif in the C-terminus tail of the M1, M3 and M5 receptors is an essential element for the anti-apoptotic response of those receptors.7

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Lyophilized Powder
For research purposes only, not for human use
Last Update: 03/01/2024

Specifications

Citations

Citations

Applications

Scientific Background

Specific Control Product

  • CHRM1 Blocking Peptide (#BLP-MR001) is the original antigen used for immunization during Anti-CHRM1 Antibody (#AMR-001) generation. The blocking peptide binds and ‘blocks’ Anti-CHRM1 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

    CHRM1 Blocking Peptide (#BLP-MR001)

Related Products

Antibodies

  1. Anti-CHRM1 (443-458) Antibody (#AMR-010)
  2. Anti-CHRM2 Antibody (#AMR-002)
  3. Anti-CHRM3 Antibody (#AMR-006)
  4. Anti-CHRM4 Antibody (#AMR-004)
  5. Anti-CHRM5 (extracellular) Antibody (#AMR-005)

Pharmacological tools

Blockers/Antagonists: peptides/peptide toxins
  1. Muscarinic Toxin 3 (#M-140)
  2. Muscarinic Toxin 7 (#M-200)
Modulators: peptides/peptide toxins
  1. Fasciculin-I (#F-650)
  2. Fasciculin-II (#F-225)

Explorer kits & Research packs

Explorer kits
  1. Muscarinic Receptor Antibody Explorer Kit (#AK-206)
  2. Muscarinic Receptor Antagonist Explorer Kit (#EK-206)

Resources

  • Muscarinic Receptor Family

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • Muscarinic Receptor Family

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

Get a 25 µl free sample

Read more about our Free Sample Program

Products

  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs
Menu
  • Ion Channels
  • G-Protein Coupled Receptors
  • Neurotrophic Factors and Receptors
  • Antibodies
  • Transporters, Exchangers and Pumps
  • Cell Imaging
  • Live Cell Flow Cytometry
  • Multiplex Staining
  • Controls
  • Kits and Packs

Resources

  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool
Menu
  • FAQ
  • Featured Products
  • Blog
  • Protocols
  • Tips
  • Articles
  • FAQs and Troubleshooting
  • Citation Search Tool

Services

  • Custom Services
  • Online Quotes
  • Orders & Shipping
Menu
  • Custom Services
  • Online Quotes
  • Orders & Shipping

Contact

Scroll to top

Bulk / Customized order